PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr042626.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family MYB
Protein Properties Length: 213aa    MW: 24027.9 Da    PI: 10.2471
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr042626.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding68.61.1e-211663148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WTteEd++l++a++ +G ++WktIa++ g++R++k+c++rw++yl
      Pbr042626.1 16 KGAWTTEEDQKLAEAIETHGAKRWKTIASKAGLNRCGKSCRLRWLNYL 63
                     79********************************************97 PP

2Myb_DNA-binding51.91.8e-1669114148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+ + +E++l+v+++k+lG++ W++Ia +++ gRt++++k++w+++l
      Pbr042626.1  69 RGNISDQEEDLIVRLHKLLGNR-WSLIAGRLP-GRTDNEIKNYWNSHL 114
                      78999*****************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129426.3221167IPR017930Myb domain
SuperFamilySSF466898.41E-3014110IPR009057Homeodomain-like
SMARTSM007171.9E-171565IPR001005SANT/Myb domain
PfamPF002499.3E-201663IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.7E-261770IPR009057Homeodomain-like
CDDcd001676.93E-121863No hitNo description
PROSITE profilePS5129420.52968118IPR017930Myb domain
SMARTSM007172.2E-1568116IPR001005SANT/Myb domain
PfamPF002491.6E-1469114IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.7E-2471118IPR009057Homeodomain-like
CDDcd001671.36E-973114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009957Biological Processepidermal cell fate specification
GO:0010090Biological Processtrichome morphogenesis
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048481Biological Processplant ovule development
GO:0048629Biological Processtrichome patterning
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 213 aa     Download sequence    Send to blast
MKGGKAMKNT KRKVNKGAWT TEEDQKLAEA IETHGAKRWK TIASKAGLNR CGKSCRLRWL  60
NYLRPNIKRG NISDQEEDLI VRLHKLLGNR WSLIAGRLPG RTDNEIKNYW NSHLSKRISQ  120
KEKENGANLT RKMISTDHQK DHVQMKEDAS LQEAATSTST TSASSSAASK GGDQNSNINI  180
DVDDFFDFSN EGSLNLEWVS KFLEQDHGRW LN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-301411825128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009347579.11e-156PREDICTED: transcription factor WER-like
SwissprotP102904e-53MYBC_MAIZE; Anthocyanin regulatory C1 protein
SwissprotQ962768e-54MYB23_ARATH; Transcription factor MYB23
TrEMBLM5WVH01e-112M5WVH0_PRUPE; Uncharacterized protein
STRINGPOPTR_0003s06320.15e-87(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF21483288
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G40330.13e-53myb domain protein 23